⌘ Services

Our Capabilities

Company

About Us
Mission
History
Facility
Career
News

Since 1984

Trusted Partner

40+ years of excellence in custom synthesis and bioconjugation services.

Learn More →

Products & Services

Oligonucleotides

Peptides

Molecular Biology

Bioconjugation

Immuno Chemistry

Bioanalytical Services

Oligonucleotide Services ›
Custom Oligo Synthesis ›
Oligo Modification ›
Oligo Bioconjugation ›
Speciality Oligonucleotide Synthesis ›
Analytical & QC Services ›
Development Services ›
Formulation & Product Development ›

Custom Peptide Type ›
Custom Peptide Synthesis ›
Peptide Modifications ›
Specialized Peptide Technologies ›
Catalog Peptides ›
Peptide Bioconjugation ›
Peptide Purification & Analytics ›

Molecular Biology Services ›

Bioconjugation Service ›
Biomolecule Conjugates ›

Immuno Services ›
Antibody Engineering & Conjugation ›

Bioanalytical Services ›

OligoTech at BSI
Oligo Services at BSI
OligoLS RUO
OligoDX Diagnostic
OligoTX Therapeutic

Analytical & QC Services at BSI
Oligo Release QC Services
Oligo Process Development

Analytical Method Development
Oligo Stability Study

Custom Oligos at BSI
Custom DNA Synthesis
HT DNA Plate Oligos
Long DNA Synthesis
Custom RNA Synthesis
HT RNA Plate Oligos
Long RNA Synthesis
Custom siRNA Synthesis
Large-Scale Oligonucleotide ›
Purification Services

Modification by Types ›
Modification by Properties ›
Modification by Applications ›
Modification by Name

Large-Scale Oligonucleotide
Large-Scale DNA Synthesis
Large-Scale RNA Synthesis

Modification by Type at BSI
Hapten‑Tagged/Affinity Ligand
Backbone Modifications
Chelators
Conjugation Modifications
Cross‑Linking Bases
Cleavable & Non-cleavable Linkers
DNA Base Analogs
Fluorescence Dyes
Fluorescence Bases
Internal Modifications
RNA Specific Capping
RNA Base Analogs
Spacer & Linkers
Sugar Modifications
Terminal Modification (Caps)
Quenchers
Intercalators
Halogenated Bases
Phosphorylation Modifier
Reactive Handlers
Redox / Electrochemical
Small Molecule Functional Tags ›

Puromycin-mRNA-Display-Signal

Modification by Property at BSI
2′→5′ phosphodiester linkage
Affinity Binding and Capturing
Affinity & Hybridization Control
Inverted Base Oligo Modifications
Cleavable Fluorescent Probes
Convertible Bases
Deuterated Bases
Degenerate Bases
Fluorescent Quenching Signal Suppression
Intercalator Base Modifications
Metal Chelation Modifications
Non-Canonical Structures
Nuclease Resistance & Stability
Photoswitchable Markers
Photo Regulation
Reverse 5' -> 3' Oligo Synthesis
Universal Bases

Modification by Application at BSI
Antisense (ASO, SSO, Gapmers)
siRNA & miRNA
Delivering and Targeting
Conjugation to Antibody (ADC/AOC)
Epigenetics
Cell Delivery and Uptake
DNA Damage Repair
DNA Cross Linking and Ligation
Mutagenesis and Methylation
Chemical Ligation
Colorimetric Detection
Ligation Blocking
Controlled Release / Cleavable Linkers
Photo-Regulation / Photo Cleavage
Structure–Activity Studies
Modification for Bioorthogonal Conjugation
Chain Terminators
Caged Oligonucleotides
Electrochemical Sensing Readout

Speciality Oligonucleotide Synthesis
Therapeutic Modalities ›
Advanced Chemistries Platforms ›
Advanced Oligo Architecture ›
Conjugation Handle Modifications ›
PCR Detection Probes ›
Hybridization Probes ›
Imaging & Spatial Biology Probes ›
PCR Clamp Technology

Custom Oligo Bioconjugation
Tissue & Receptor Targeting ›
Cellular Uptake & Intracellular Delivery ›
Oligo–Macromolecule Conjugates ›
Oligo-Drug Conjugates (ODCs) ›
Oligo-Small Molecule Conjugates ›
Polymer-Oligo Conjugates ›

Therapeutic Oligo Services
Advanced siRNA Architectures
Antisense Oligo (ASO)
Gapmer ASO
Steric-Blocking ASO
Splice-Switching Oligo (SSO)
Aptamers
miRNA Mimics
Therapeutic Oligo Bioconjugation

Tissue Receptor Targeting Oligo Services
Oligo-GalNAc Conjugation
Oligo-Folate Conjugation
Receptor-Targeting Ligand Conjugates

Cellular Uptake and Delivery Services
Extrahepatic Oligonucleotide Delivery
Peptide-Oligo Conjugates
Lipid-Conjugated Oligos ›
Endosomal Escape Options

Lipid-Modified Oligonucleotide Overview
Saturated Fatty Acid Oligos
Unsaturated Fatty Acid Oligos
Cholesterol & Sterol Oligos
Phospholipid & PEG-Lipid Oligos
Steroid & Vitamin Lipid Oligos
Specialty Lipid/ Nucleolipid Oligo

Oligo-Macromolecule at BSI
Antibody-Oligo Conjugates
Nanobody-Oligo Conjugates
Enzyme-Oligo Conjugates
Oligo–Carrier Protein Conjugates
Recombinant Protein-Oligo Conjugates
Streptavidin-Oligo Conjugates

Oligo-Drug Conjugation Services
Oligo-Drug Conjugates
Cleavable Linker Technologies
Controlled Release Strategies
Bioorthogonal Conjugation

Small Molecule Oligo Conjugates Overview
Delivery Modifiers
Targeting Ligands
Affinity Labels
Fluorescent Labeled Oligos
Biotinylated Oligos

Oligo-Polymer Conjugation Overview
Oligo-PEGylation
Oligo-Synthetic Polymer Conjugates
Oligo-PAMAM Conjugates
Oligo-Biodegradable Polymer Conjugates
Smart Polymer–Oligo Conjugates

Advanced Chemistry Platform Overview
Phosphodiester Linkage Reengineering ›
Advanced Sugar Modified XNA ›
Advance XNA Backbone Analogs
Artificial Base Pair Systems

Phosphodiester Linkage Reengineering Overview
Chiral Phosphorothioate (Rp/Sp)
Phosphonoacetate (PACE)
Phosphoramidate (PN bond)
Peptide Nucleic Acid (PNA)
Morpholino (PMO/TMO)

Sugar Modified XNAs Overview
Bridged Nucleic Acids (LNA/BNA)
Ethylene-Bridge Nucleic Acids (ENA)
Constrained Ethyl Nucleic Acids (cEt)
2'-O-NMA (NMA)
2'-Amino Nucleic Acids (2'-AmNA)
Unlock Nucleic Acids (UNA)

Advanced Oligo Architecture Overview
Circular Oligos
Branched Oligos
Dendrimer Oligonucleotide Synthesis
Multimeric Oligonucleotide Synthesis

Conjugation Handle Overview
Click Chemistry Modifier
Amino Modifiers
Thiol Modifiers
Carbonyl Reactive Modifiers
Carboxyl Modifiers
Multifunctional Modifiers
Crosslinker Modifiers

qPCR Probe Services Overview
Dual-Labeled Probe Technologies
Dual-Labeled Hydrolysis Probes
Molecular Beacon Probes
Scorpion Probes
Plexor Primer
FRET Probes
MGB Probes
Multiplex qPCR Probes
Affinity-Enhanced Probes
Mutation Detection Probes
Pathogen Detection Probes

Hybridization probe service overview
DNA/RNA hybridization probes
PNA Hybridization Probes
Branched DNA (bDNA) Probes
Telomere Probes
Capture probe
Custom Hybridization Probe Sets

Imaging & Spatial Biology Probes Overview
Fluorescent Imaging Probes
Near-Infrared (NIR) Imaging Probes
smFISH Probes
RNA Imaging Probes
MERFISH Probes
seqFISH Probes
Spatial Transcriptomic Probe Sets
OligoPaint Probes
Chromosome Painting Probes
Telomere PNA FISH Probes
Custom Imaging Probe Design

Formulation & Product Development at BSI
Custom Formulation Development
LNP Encapsulation
Packaging & Fill-Finish

PeptideTech at BSI
Research Use Peptides (RUO)
Therapeutic/Clinical Peptides
Diagnostic Peptides
Peptide Release QC

Custom Peptide Synthesis Overview
Standard Peptides
Custom Peptide Libraries
Custom Peptide Arrays
Large-Scale Manufacturing
Long Peptides
Difficult Peptides ›

Hydrophobic Peptides
Cysteine-rich Peptides
Aggregation-prone Peptides

Hydrophobic Peptides
Aggregation-prone Peptides

Peptide Modification Overview
Structural Modifications ›
Functional Modifications ›
Conjugation Chemistry ›
Biological Modifications ›

Structural Modifications Overview
Terminal Modifications ›
Amino Acid Substitutions ›
Backbone Modifications
Side-Chain Functionalization ›
Peptide Cyclization ›

Terminal Modification Overview
N-terminus Modification
C-terminus Modification

Amino Acid Substitution Overview
Stereochemical D-Amino Acids
Non-Proteinogenic (Unnatural) Amino Acids

Side-Chain Functionalization Overview
Cysteine-Specific Chemistry
Lysine-Selective Chemistry

Cyclic Peptide Modification Overview
Head-to-tail Cyclization
Side-chain Cyclization
Terminus-to-side Chain Cyclization

Fluorescent Labeling modification
Stable Isotope Labeling
PEGylation
Biotinylation
Click Chemistry Modifications
Linkers, Spacers & Crosslinking
Site-Specific Peptide Modification
Cleavable & Stimuli-Responsive Linkers
Targeting & Delivery Modification

Peptide Crosslinking Chemistry

Post-Translational Modifications
PTM Overview
Phosphorylated Peptides
Glycopeptides
Acetylated Peptides
Methylated Peptides
Sulfated Peptides
Citrullinated Peptides
Ubiquitinated Peptides
SUMOylated Peptides

Peptide Purification Services
Peptide Analytical Services

Specialized Peptide Technologies Overview
Architecture Engineered Peptides ›
Conformational Engineered Peptides ›
Hybrid Peptide Architecture ›
Functionally Engineered Peptides ›
Advanced Peptide Design & Discovery

Architecture Engineered Peptides Overview
Branched Peptide Synthesis
Multivalent Peptide Synthesis ›

Multivalent Peptides Overview
Multiple Antigen Peptide (MAPs)
Dendrimer Peptides
Multiepitope Peptides
Bispecific Peptides

Conformational Engineered Peptides Overview
Cyclic Peptides
Staple Peptides
Helical Peptides
Macrocyclic Peptides
Bicyclic Peptide

Hybrid Peptide Architecture Overview
Glycopeptides
Lipopeptides
PEGylated Peptides

Functionally Engineered Peptides Overview
Analytical & Quantitative Peptide ›
Detection & Reporter Peptides ›
Affinity & Captured Peptides ›

Targeted Proteomics & Quantitative LC-MS Peptides
Stable Isotope-Labeled Peptides
AQUA Peptides

Detection & Reporter Peptides Overview
Fluorescent-Labeled Peptides
FRET Peptides
Enzyme Reporter Peptides
Photoreactive Peptides

Biotinylated Peptides
Affinity Tag Peptides

Catalog Peptide Libraries
MOG Peptide
Beta Amyloid
Cosmetic Peptide
More Catalog Peptide Listing...

Peptide Bioconjugation
Peptide-Oligonucleotide Conjugation ›
Peptide-Protein Conjugation ›
Peptide-Polymer Conjugation ›
Peptide-Drug Conjugation ›
Peptide-Small Molecule/Ligand Conjugation (Non-Drug) ›
Peptide Imaging Conjugates ›

Peptide-Oligo Overview
Peptide-siRNA Conjugation
Peptide-DNA Conjugation
Peptide-ASO Conjugation
Peptide-PNA Conjugation
Peptide-PMO Conjugation

Peptide-Protein Overview
Peptide Carrier Protein Conjugation
Peptide Enzyme Conjugation
Peptide Antibody Conjugation
Peptide–Recombinant Protein Conjugation

Peptide-Polymer Conjugation Overview
Peptide-PEGylation
Peptide–Synthetic Polymer Conjugation
Peptide–Biodegradable Polymer Conjugation

Peptide–Drug Conjugates (PDCs) Overview
Peptide–Lipid Drug Conjugates
Cleavable Linker Peptide–Drug Conjugates (PDCs)
Site-Specific Peptide-Drug
Oncology Peptide Drug Conjugates

Peptide-Small Molecule/Ligand Overview
Peptide–Fluorophore Conjugates
Peptide–Affinity Tag Conjugates
Peptide–Vitamin / Cofactor Conjugates
Peptide–Targeting Ligand Conjugates
Glycopeptide
Lipopeptide (Peptide-Lipid)
Peptide GalNAc Conjugates

Peptide-Imaging Conjugate Overview
Peptide-Fluorophore Conjugates
Near-infrared Peptide Conjugates
Radiolabeled-Compatible (Chelate) Peptides
Dual-label Imaging Conjugates

Molecular Biology Services at BSI
Long RNA Transcript Services
mRNA Transcription Services
Gene and DNA Synthesis
Cloning & Vector Construction
Plasmid DNA Preparation
Protein Expression
Recombinant Protein Purification
RNA & Protein Delivery (LNP Formulation)
Protein Modification & Bioconjugation

Conjugation Service Overview
Site-Specific Conjugation
Payloads, Label & Tags
Cross Linkers, Spacers
Chemistries & Reactive Handles
Carrier & Delivery System
Surfaces & Solid-Support
Development & scale-up
Analytical Characterization
Application Based Conjugation

Biomolecule Conjugates
Antibody Bioconjugates
Oligo Conjugates
Peptide Bioconjugates
Protein Conjugates
Drug Bioconjugates (ODC)
Small Molecule/Hapten Conjugates
Polymer Bioconjugation ›
Lipid & Liposome Bioconjugates
Glycoconjugates
Nanomaterials ›
Metal Chelator Bioconjugates

Polymer Bioconjugation Overview
PEGylation Bioconjugation
Synthetic Polymer Bioconjugation
Biodegradable Polymer Bioconjugation

Nanomaterials Overview
Gold Nanoparticle Bioconjugation

Antibody Purification
Antibody Characterization
ELISA Development & Optimization

Antibody Engineering and Conjugation Overview
Fluorescent Labeling
Secondary Detection Probes
Enzyme Labeling (HRP, AP)
Biotin Conjugation
Nanoparticle Conjugation
Oligonucleotide Conjugation
Antibody Drug Bioconjugation (ADC)
Small Molecule / Ligand Conjugation
Liposome Conjugation
Polymer Conjugation
Fragmentation

Amino Acid Analysis
Endotoxin Assay
Mass Spectrometry
Peptide Identity Confirmation
Peptide Counterion Analysis
Bioburden Assay
Salt-Sodium Content Analysis
Water Content Analysis
Residual Chemical Analysis
pH Analysis
Solubility Testing
Time-Schedule Stability Study
Customer / Bundled Panel

Custom Solutions

Designed for your research & pipeline

High Quality

Rigorous QC and on-time delivery

Scalable Manufacturing

From bench-scale to commercial scale

Expert Support

Scientist-to-scientist consultation

Need help finding the right solution?

Speak to a Scientist →

Resources

Educational Resources ›
Scientific Tools ›

Educational Articles
Frequently Asked Questions
Literature Vault
Newsletters

Oligo Properties Calculator
Peptide Properties Calculator
Peptide Design Library
PNA Properties Calculator
Bioinformatic Glossary
Genetic Code Table
Unit Conversion Tables

Free Tools

Scientific Resources

Calculators, design tools, and educational content to support your research.

Explore →

Contact Quote Order Login / Register

Antimicrobial & Host-Defense Peptides Products

Antimicrobial & Host-Defense Peptides

Antimicrobial and Related Peptides

Alloferons

Cecropin Peptides

Cathelin-Related Antimicrobial Peptides (CRAMP)

Defensins

Mastoparans

Pseudin Peptides and Analogs

Temporins

Bacterial Peptides

Ceratotoxin Peptides

Melittins

Microbial

Peptidoglycan Peptides

ALL

αβδγ

If you are unable to find your desired product please contact us for assistance or send an email to info@biosyn.com

Product Name	Catalog #	Unit	Price/Unit
5 - FAM - LC - LL - 37 5-FAM-LC-LLGDFFRKSKEKIGKEFKRIVQRIKDFLRNLVPRTES	13998-001	0.1 mg	$431	Cart Inquire
Alloferon 1 HGVSGHGQHGVHG	14000-01	1mg	$620	Cart Inquire
Alloferon 2 GVSGHGQHGVHG	14001-01	1mg	$620	Cart Inquire
Andropin VFIDILDKVENAIHNAAQVGIGFAKPFEKLINPK	10388-01	1 mg	$828	Cart Inquire
Antimicrobial Anionic Peptide, Surfactant-associate GADDDDD	10376-01	1 mg	$743	Cart Inquire
Antimicrobial Anionic Peptide, Surfactant, ovine DDDDDDD	10377-01	1 mg	$743	Cart Inquire
Apidaecin IA GNNRPVYIPQPRPPHPRI	10387-01	1 mg	$810	Cart Inquire
Apidaecin IB GNNRPVYIPQPRPPHPRL	10386-01	1 mg	$405	Cart Inquire
Aurein 1.1 GLFDIIKKIAESI-CONH2	10385-01	1 mg	$743	Cart Inquire
Bac2A; Bactenecin 2A RLARIVVIRVAR-CONH2	14002-01	1mg	$405	Cart Inquire
Bactenecin, bovine RLCRIVVIRVCR (Disulfide bridge: 3-11)	10454-01	1 mg	$998	Cart Inquire
Bactenecin bovine RLCRIVVIRVCR (Disulfide bridge: 3 - 11)	10454-005	0.5 mg	$579	Cart Inquire
Bacterial Sortase Substrate I, FRET DABCYL - LPETG - EDANS	14285-01	1 mg	$783	Cart Inquire
Bacterial Sortase Substrate II Dabcyl/Edans Dabcyl - QALPETGEE - Edans	14286-01	1 mg	$876	Cart Inquire
Biotin - LC - LL - 37 Biotin-LC-LLGDFFRKSKEKIGKEFKRIVQRIKDFLRNLVPRTES	14003-005	0.5 mg	$966	Cart Inquire
Bombinin - like Peptide (BLP - 1) GIGASILSAGKSALKGLAKGLAEHFAN-CONH2	10357-01	1 mg	$1,098	Cart Inquire
Brevinin - 1 FLPVLAGIAAKVVPALFCKITKKC (Disulfide bridge: 18-24)	10358-01	1 mg	$1,587	Cart Inquire
CAP-18, rabbit GLRKRLRKFRNKIKEKLKKIGQKIQGLLPKLAPRTDY	10362-01	1 mg	$1,148	Cart Inquire
CAP - 18, rabbit GLRKRLRKFRNKIKEKLKKIGQKIQGLLPKLAPRTDY	10362-005	0.5 mg	$764	Cart Inquire
Carnobacteriocin B2 VNYGNGVSCSKTKCSVNWGQAFQERYTAGINSFVSGVASGAGSIGRRP no bond	10381-005	0.5 mg	$1,688	Cart Inquire
Cecropin A KWKLFKKIEKVGQNIRDGIIKAGPAVAVVGQATQIAK-CONH2	10348-01	1 mg	$966	Cart Inquire
Cecropin A (10348-005) KWKLFKKIEKVGQNIRDGIIKAGPAVAVVGQATQIAK - NH2	10348-005	0.5 mg	$579	Cart Inquire
Cecropin B KWKVFKKIEKMGRNIRNGIVKAGPAIAVLGEAKAL-CONH2	10349-01	1 mg	$1,317	Cart Inquire
Cecropin B (10349-005) KWKVFKKIEKMGRNIRNGIVKAGPAIAVLGEAKAL - NH2	10349-005	0.5 mg	$579	Cart Inquire
CFP10 (71–85) EISTNIRQAGVQYSR	10462-01	1 mg	$405	Cart Inquire
CFTR (108 - 117), Pseudomonas aeruginosa Inhibitor SYDPDNKEER	10463-01	1 mg	$728	Cart Inquire
Competence Stimulating Peptide-1, CSP-1 EMRLSKFFRDFILQRKK	14255-01	1 mg	$405	Cart Inquire
Competence-stimulating peptide -2, CSP-2 EMRISRIILDFLFLRKK	14256-01	1 mg	$405	Cart Inquire
CRGKA, Giardia Variable Surface Proteins Conserved CRGKA	10466-01	1 mg	$375	Cart Inquire
Dermcidin, DCD - 1L SSLLEKGLDGAKKAVGGLGKLGKDAVEDLESVGKGAVHDVKDVLDSVL	14264-001	0.1 mg	$467	Cart Inquire
[Des Ala20, Gln34] Dermaseptin ALWKTMLKKGTMALHAGK	10379-01	1 mg	$810	Cart Inquire
Drosocin GKPRPYSPRPTSHPRPIRV	10396-01	1 mg	$405	Cart Inquire
Elafin AQEPVKGPVSTKPGSCPIILIRCAMLNPPNRCLKDTDCPGIKKCCEGSCGMACFVPQ (Disufide bonds between Cys16 - Cys45, Cys23 - Cys49, Cys32 - Cys44, Cys38 - Cys53)	14265-001	0.1 mg	$783	Cart Inquire
flg22, Flagellin Fragment QRLSTGSRINSAKDDAAGLQIA	14288-01	1 mg	$594	Cart Inquire
GLU Construct TGAQTIKGQKLYFKANGQQVKG	10391-01	1 mg	$1,013	Cart Inquire
Glucosyltransferase I (442-462), Streptococcus mut DANFDSIRVDAVDNVDADLLQ	10390-01	1 mg	$1,013	Cart Inquire
hBD - 1 β - Defensin - 1 human DHYNCVSSGGQCLYSACPIFTKIQGTCYRGKAKCCK (Disulfide bridge: 5-34, 12-27, 17-35)	10931-001	0.1 mg	$1,007	Cart Inquire
hBD - 3β - Defensin - 3human GIINTLQKYYCRVRGGRCAVLSCLPKEEQIGKCSTRGRKCCRRKK (Disulfide bridge: 11-40, 18-33, 23-41)	10932-001	0.1 mg	$1,007	Cart Inquire
hBD - 4, β - Defensin - 4, human ELDRICGYGTARCRKKCRSQEYRIGRCPNTYACCLRK (Disulfide bridge: 6-33; 13-27; 17-34)	10933-001	0.1 mg	$1,350	Cart Inquire
HCAM - 2 6 - FAM - VFDAVTDVIIKNNLKECGLY	14289-01	1 mg	$1,007	Cart Inquire
HEL (46-61) NTDGSTDYGILQINSR	10351-01	1 mg	$912	Cart Inquire
Helicobacter pylori, Hp (2 - 20) AKKVFKRLEKLFSKIQNDK	13997-01	1mg	$728	Cart Inquire
Histatin - 3 (H3) DSHAKRHHGYKRKFHEKHHSHRGYRSNYLYDN	10370-01	1 mg	$1,350	Cart Inquire
Histatin - 5 DSHAKRHHGYKRKFHEKHHSHRGY	10355-01	1 mg	$635	Cart Inquire
Histatin - 8 [Hemagglutination] - Inhibiting Peptide KFHEKHHSHRGY	10356-01	1 mg	$777	Cart Inquire
HNP - 1, Defensin Human Neutrophil Peptide - 1 ACYCRIPACIAGERRYGTCIYQGRLWAFCC (Disulfide bridge: 2-30, 4-19, 9-29)	10934-001	0.1 mg	$653	Cart Inquire
HNP - 2, Defensin Human Neutrophil Peptide - 2 CYCRIPACIAGERRYGTCIYQGRLWAFCC (Disulfide bridge: 1-29, 3-18, 8-28)	10935-001	0.1 mg	$710	Cart Inquire
Human Lactotransferrin (37 - 61), Lactoferricin H TKCFQWQRNMRKVR - G - PPVSCIKRDS (Disulfide between Cys3 and Cys20)	14266-01	1 mg	$764	Cart Inquire
Human Platelet Factor IV 18, C18G ALYKKLLKKLLKSAKKLG	14267-01	1 mg	$405	Cart Inquire
Indolicidin ILPWKWPWWPWRR-CONH2	10353-01	1 mg	$467	Cart Inquire
Innate Defense Regulator-1 (IDR-1) KSRIVPAIPVSLL	10394-01	1 mg	$743	Cart Inquire
LEAP-1, Hepcidin, human DTHFPICIFCCGCCHRSKCGMCCKT (Disulfide bridges: 7-23, 10-13, 11-19, 14-22)	10371-001	0.1 mg	$710	Cart Inquire
LEAP - 2 (38 - 77) (Human) MTPFWRGVSLRPIGASCRDDSECITRLCRKRRCSLSVAQE	10374-01	1 mg	$1,520	Cart Inquire
Lethal Factor (LF) Inhibitor Anthrax related MKARRKKVYP- NHOH	10453-01	1 mg	$878	Cart Inquire
LF 20 Consensus Peptide. Anthrax Related Lethal Fa MLARRKKVYPYPMEPTIAEG-CONH2	10452-01	1 mg	$1,047	Cart Inquire
LL17 - 29 FKRIVQRIKDFLR	14271-01	1 mg	$491	Cart Inquire
LL17 - 32 FKRIVQRIKDFLRNLV	14272-01	1 mg	$405	Cart Inquire
LL-37, Antimicrobial Peptide, human [LL-37, 37 aa]	10359-01	1 mg	$588	Cart Inquire
LL - 37 fragment (18 - 37), LL - 18 - 37 KRIVQRIKDFLRNLVPRTES	14269-01	1 mg	$392	Cart Inquire
LL-37 pentamide LLGNFFRKSKQKIGKQFKRIVQRIKNFFRNLVPRTQS	10364-01	1 mg	$1,148	Cart Inquire
LL-37, reverse sequence SETRPVLNRLFDKIRQVIRKFEKGIKEKSKRFFDGLL	10392-005	0.5 mg	$467	Cart Inquire
LL - 37, scrambled GLKLRFEFSKIKGEFLKTPEVRFRDIKLKDNRISVQR	14270-01	1 mg	$1,007	Cart Inquire
Listeria monocytogenes Listeriolysin O; LLO (91 - 99) GYKDGNEYI	14284-01	1 mg	$405	Cart Inquire
Lytic Peptide, SB - 37 MPKWKVFKKIEKVGRNIRNGIVKAGPAIAVLGEAKALG	10354-01	1 mg	$1,182	Cart Inquire
Lytic Peptide, Shiva - 1 MPRLFRRIDRVGKQGILRAGPAIALVGDARAVG	10352-01	1 mg	$1,013	Cart Inquire
Magainin 1 GIGKFLHSAGKFGKAFVGEIMKS	10347-01	1 mg	$467	Cart Inquire
Magainin 1 (10347-005) GIGKFLHSAGKFGKAFVGEIMKS	10347-005	0.5 mg	$405	Cart Inquire
Magainin 2 GIGKFLHSAKKFGKAFVGEIMNS	10346-01	1 mg	$467	Cart Inquire
Magainin 2-10346-005 GIGKFLHSAKKFGKAFVGEIMNS	10346-005	0.5 mg	$405	Cart Inquire
mCRAMP, mouse GLLRKGGEKIGEKLKKIGQKIKNFFQKLVPQPEQ	10360-01	1 mg	$912	Cart Inquire
Melittin, honey bee NH2-GIGAVLKVLTTGLPALISWIKRKRQQ-CONH2	10393-01	1 mg	$594	Cart Inquire
Metalnikowin IIA VDKPDYRPRPWPRPN	10398-01	1 mg	$761	Cart Inquire
MSP - 1 (20 - 39), Merozoite Surface Peptide 1 VTHESYQELVKKLEALEDAV	10457-01	1 mg	$845	Cart Inquire
MSP - 1 P2, Malaria Merozoite Surface Peptide - 1 GYRKPLDNIKDNVGKMEDYIKK	10455-01	1 mg	$1,013	Cart Inquire
MSP - 1 P3, Malaria Merozoite Surface Peptide - 1 KLNSLNNPHNVLQNFSVFFNK	10456-01	1 mg	$998	Cart Inquire
Mundticin KYYGNGVSCNKKGCSVDWGKAIGIIGNNSAANLATGGAAGWSK (Disulfide bridge: 9-14)	10384-005	0.5 mg	$1,688	Cart Inquire
Mundticin KS KYYGNGVSCNKKGCSVDWGKAIGIIGNNSAANLATGGAAGWKS (Disulfide bridge: 9-14)	10383-005	0.5 mg	$1,688	Cart Inquire
Mycobacterium tuberculosis Protein Ag85A LTSELPGWLQANRHVKPTGS	10468-01	1 mg	$375	Cart Inquire
Mycobacterium Tuberculosis Protein Ag85A - CD8 MPVGGQSST	10467-01	1 mg	$710	Cart Inquire
OV-1, Sheep KNLRRIIRKIIHIIKKYG	10365-01	1 mg	$828	Cart Inquire
OV-2, Sheep LRRIIRKIIHIIKK-CONH2	10366-01	1 mg	$743	Cart Inquire
OV-3, sheep IRRIIRKIIHIIKK-CONH2	10367-01	1 mg	$743	Cart Inquire
P38 (411 - 425), M. leprae AGGGVTLLQAAPALD	10458-01	1 mg	$810	Cart Inquire
P61 (343 - 355), M. leprae RVAQIRTEIENSD	10459-01	1 mg	$761	Cart Inquire
P62 (417 - 429), M. leprae LLQAAPALDKLKL	10460-01	1 mg	$761	Cart Inquire
P69 (522 - 534), M. leprae PEKTAAPASDPTG	10461-01	1 mg	$761	Cart Inquire
P. falciparum Liver - Stage Antigen 3 - NRII (LSA3 - NRII) LEESQVNDDIFNSLVKSVQQEQQHNV	10469-01	1 mg	$1,133	Cart Inquire
Piscicolin 126 KYYGNGVSCNKNGCTVDWSKAIGIIGNNAAANLTTGGAAGWNKG (Disulfide bridge: 9-14)	10382-005	0.5 mg	$1,587	Cart Inquire
Plasmodium yoelii Circumsporozoite Protein, PyCSP (280-288) SYVPSAEQI	10389-01	1 mg	$743	Cart Inquire
Protegrine - 1 (PG - 1), amide RGGRLCYCRRRFCVCVGR - NH2 (disulfide bridge:6 - 15 and 8 - 13)	14273-01	1 mg	$1,841	Cart Inquire
Protegrine - 1 (PG - 1), amide-14273-005 RGGRLCYCRRRFCVCVGR - NH2 (disulfide bridge:6 - 15 and 8 - 13)	14273-005	0.5 mg	$1,040	Cart Inquire
PyCSP (57–70) Plasmodium Yoelii Circumsporozoite P KIYNRNIVNRLLGD	10464-01	1 mg	$743	Cart Inquire
Pyrrhocoricin N VDKGSYLPRPTPPRPIYNRN	10397-01	1 mg	$392	Cart Inquire
rCRAMP GLVRKGGEKFGEKLRKIGQKIKEFFQKLALEIEQ	10361-01	1 mg	$1,148	Cart Inquire
rCRAMP - 10361-005 GLVRKGGEKFGEKLRKIGQKIKEFFQKLALEIEQ	10361-005	0.5 mg	$764	Cart Inquire
RL-37 RLGNFFRKVKEKIGGGLKKVGQKIKDFLGNLVPRTAS	10368-005	0.5 mg	$912	Cart Inquire
Serorphin, BSA (399-404) YGFQNA	10399-01	1 mg	$675	Cart Inquire
SKIGKV - NH2 SKIGKV-CONH2	10450-01	1 mg	$912	Cart Inquire
SMAP 29, Sheep Myeloid Antimicrobial Peptide 29 RGLRRLGRKIAHGVKKYGPTVLRIIRIAG	10363-01	1 mg	$764	Cart Inquire
SP2 GFRLTNFGYFEPGK	10369-01	1 mg	$743	Cart Inquire
SPase I FRET Substrate Dabcyl - AGHDAHASET - Edans	14290-01	1 mg	$635	Cart Inquire
Staphylococcal Enterotoxin B Domain (SEB) (144 - 153) KKKVTAQELD	14291-01	1 mg	$405	Cart Inquire
(T1BT*) - linear DPNANPNVDPNANPNVNANPNANPNANPEYLNKIQNSLSTEWSPCSVT	13996-01	1mg	$1,229	Cart Inquire
Temporin A, amide FLPLIGRVLSGIL - NH2	14274-01	1 mg	$405	Cart Inquire
Temporin L amide FVQWFSKFLGRIL - NH2	14275-01	1 mg	$405	Cart Inquire
Theromacin (49 - 63) QRLPNNKQCRCINAR (C57-C59 disulfide bridge)	10372-01	1 mg	$912	Cart Inquire
Ubiquitin (65-76), (Ub2) STLHLVLRLRGG	10395-01	1 mg	$761	Cart Inquire

Show Rows :

Why Choose Bio-Synthesis

Trusted by biotech leaders worldwide for over 45 years of delivering high-quality, fast, and scalable synthetic biology solutions.

Greetings, Researchers,

Please be advised that any information, guidelines, write-ups, and oral/video/graphic content on our website are intended solely as general guidelines.

It is the researcher's sole responsibility to conduct thorough research on the design of products intended for their experiments before submitting
their designs to Biosynthesis for production feasibility review.

Thank you for your understanding.

Quick Links

Email : info@biosyn.com
Toll Free: 800.227.0627 | 1.972.420.8505
Bio-Synthesis Inc, 800 Mario Court, Lewisville, TX 75057